PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID SapurV1A.0040s0200.2.p
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; fabids; Malpighiales; Salicaceae; Saliceae; Salix
Family Dof
Protein Properties Length: 327aa    MW: 34763.7 Da    PI: 9.5617
Description Dof family protein
Gene Model
Gene Model ID Type Source Coding Sequence
SapurV1A.0040s0200.2.pgenomeJGIView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1zf-Dof121.92.1e-3869129262
                  zf-Dof   2 kekalkcprCdstntkfCyynnyslsqPryfCkaCrryWtkGGalrnvPvGggrrknkkss 62 
                             +e+alkcprC+stntkfCy+nnyslsqPr+fCk+CrryWt+GGalr vPvGgg+r+nkk++
  SapurV1A.0040s0200.2.p  69 PEAALKCPRCESTNTKFCYFNNYSLSQPRHFCKTCRRYWTRGGALRSVPVGGGCRRNKKTK 129
                             67899*****************************************************987 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
ProDomPD0074782.0E-3553125IPR003851Zinc finger, Dof-type
PfamPF027011.9E-3272127IPR003851Zinc finger, Dof-type
PROSITE profilePS5088429.21773127IPR003851Zinc finger, Dof-type
PROSITE patternPS01361075111IPR003851Zinc finger, Dof-type
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0003002Biological Processregionalization
GO:0006355Biological Processregulation of transcription, DNA-templated
GO:0009611Biological Processresponse to wounding
GO:0009625Biological Processresponse to insect
GO:0009753Biological Processresponse to jasmonic acid
GO:0010439Biological Processregulation of glucosinolate biosynthetic process
GO:0005634Cellular Componentnucleus
GO:0044212Molecular Functiontranscription regulatory region DNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 327 aa     Download sequence    Send to blast
MVFSSVPVYL DPHSWQQQQQ PGQQLGASDE SPQLPPLPPL PHVGGSGTAG SIRPGSMSDR  60
ARLAKIPQPE AALKCPRCES TNTKFCYFNN YSLSQPRHFC KTCRRYWTRG GALRSVPVGG  120
GCRRNKKTKS QSSSKSPVSS ERQMGSTSST STSALPSQII GHFPQQQTQY PFMTSLHNLT  180
QFGVANIGLN FGGIQGQMGS ASGHAVGQAD MGFQIGSSSG MGSSSFLSAG GVQQFPFFEP  240
PPTGLYPFQS EGAETPTGIP GESNQLRSMA SSSRVSQLAP VKSEGNPGLN LSKPYLGIPE  300
NSQYYWGGNT WTDLSGLNSS STSHFL*
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_002299879.11e-178hypothetical protein POPTR_0001s24540g
TrEMBLB9GJP71e-178B9GJP7_POPTR; Uncharacterized protein
STRINGPOPTR_0001s24540.11e-178(Populus trichocarpa)
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT1G07640.24e-48Dof family protein